PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010523420.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Cleomaceae; Tarenaya
Family LFY
Protein Properties Length: 379aa    MW: 42298.2 Da    PI: 7.5727
Description LFY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010523420.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FLO_LFY184.86.8e-5711731175
         FLO_LFY   1 mdpeafsaslfkwdpraaaaapparlleeaavseapleaaaaaaarklreleelfkayGvryltvakiaelGftvstLvdmkdeelddlmkslse 95 
                     mdpe f+aslf+wd+  ++ +pp   +           a+++a   +l +le l+ ayG+ry+t+akiaelGft+stLv+mk+eeldd+m+sls+
  XP_010523420.1   1 MDPEGFTASLFRWDASRTTPQPPPATA-----------AEVSAFGLRLGGLEGLLGAYGIRYYTAAKIAELGFTASTLVGMKEEELDDMMNSLSQ 84 
                     9*************6544433332221...........12234566789********************************************** PP

         FLO_LFY  96 ifrldllvGeryGikaavraerrrleeeeaekkrrkll........sedeet.aldalsqeglseepvqeekeaagsggeglgeaelva 175
                     ifr++llvGeryGik+avraerrrl+e+e++++rr++l        + d++t a dalsqeglseepvq+ekea g +g+++++++ ++
  XP_010523420.1  85 IFRWELLVGERYGIKSAVRAERRRLQEDEDSSRRRHFLlsssaaaaAGDSSThAHDALSQEGLSEEPVQQEKEAEGEAGRKKQQRRRKK 173
                     ***************************999999999777777777655555459*******************9888777766555444 PP

2FLO_LFY396.43.7e-121170349196385
         FLO_LFY 196 kkkkelkseededeeeeededeegsgedgeerqrehPfivtepgevargkknGLDYLfdLyeqCrefLlqvqkiakerGekcPtkvtnqvfryak 290
                     ++          ++ eee   ++   + + erqrehPfivtepgevargkknGLDYLf+LyeqCrefLlqvq++ak+rGekcP+kvtnqvfryak
  XP_010523420.1 170 RR----------KKAEEEAGGDDVDDDVAAERQREHPFIVTEPGEVARGKKNGLDYLFHLYEQCREFLLQVQSLAKDRGEKCPSKVTNQVFRYAK 254
                     11..........1111122222223334569**************************************************************** PP

         FLO_LFY 291 kagasyinkPkmrhYvhCYalhcLdeeasnalrrafkergenvGawrqacykplvaiaarqgwdidavfnahprLsiWYvPtkLrqLChlerska 385
                     k+gasyinkPkmrhYvhCYalhcLdeeasnalrrafkergenvGawrqacykpl+aia r++wdidavfnahprLsiWYvPtkLrqLCh+er+++
  XP_010523420.1 255 KSGASYINKPKMRHYVHCYALHCLDEEASNALRRAFKERGENVGAWRQACYKPLIAIAGRHDWDIDAVFNAHPRLSIWYVPTKLRQLCHAERNNN 349
                     ********************************************************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF016987.7E-1791349IPR002910Floricaula/leafy protein
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010077Biological Processmaintenance of inflorescence meristem identity
GO:0010582Biological Processfloral meristem determinacy
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0031490Molecular Functionchromatin DNA binding
GO:0042803Molecular Functionprotein homodimerization activity
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0043621Molecular Functionprotein self-association
Sequence ? help Back to Top
Protein Sequence    Length: 379 aa     Download sequence    Send to blast
MDPEGFTASL FRWDASRTTP QPPPATAAEV SAFGLRLGGL EGLLGAYGIR YYTAAKIAEL  60
GFTASTLVGM KEEELDDMMN SLSQIFRWEL LVGERYGIKS AVRAERRRLQ EDEDSSRRRH  120
FLLSSSAAAA AGDSSTHAHD ALSQEGLSEE PVQQEKEAEG EAGRKKQQRR RKKAEEEAGG  180
DDVDDDVAAE RQREHPFIVT EPGEVARGKK NGLDYLFHLY EQCREFLLQV QSLAKDRGEK  240
CPSKVTNQVF RYAKKSGASY INKPKMRHYV HCYALHCLDE EASNALRRAF KERGENVGAW  300
RQACYKPLIA IAGRHDWDID AVFNAHPRLS IWYVPTKLRQ LCHAERNNNN NNSAAPAAAA  360
FGGSVCSSAS GRDGERSRF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2vy1_A1e-1151873741186PROTEIN LEAFY
2vy2_A1e-1151873741186PROTEIN LEAFY
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00095SELEXTransfer from AT5G61850Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010523420.10.0PREDICTED: protein LEAFY-like
SwissprotO040640.0FLLH_POPTR; Floricaula/leafy homolog
TrEMBLM1LEY10.0M1LEY1_9R
STRINGPOPTR_0015s11820.11e-179(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM79072841
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G61850.11e-110floral meristem identity control protein LEAFY (LFY)